foam for noise reduction

Brand Name:Inoac

Model Number:E-4088

Place of Origin:China

EPDM E-4088 Black rubber foam automotive noise reduction and shock-proof foam Material / Feature / Application : E-4088 sponge rubber has low hardness and is black in color. It has good waterproof and shock resistance, temperature ...

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Categories:EVA Foam Underlayment

Country/Region:china

... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is with a 3 mm thick foam layer that provides optimal cushioning and sound absorption, as well as

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Brand Name:EkkoFlex

Place of Origin:Made in china

10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduction applications. Its dense, crosslinked structure effectively absorbs and dampens sound vibrations, ...

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Brand Name:HC

Model Number:IXPE3030-L

Place of Origin:CHINA

33kg/m3 IXPE Foam Underlay 200sqft/roll Noise Reduction Underlayment Black 3mm IXPE Normal Underlayment , Noise Reduction Underlayment Features Designed for noise reduction and cushioning under flooring Crush resistant, durable and high acoustic ...

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Brand Name:Future Tech

Model Number:FT-EM5002

Place of Origin:Shenzhen China

...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam...

Brand Name:YUDA

Model Number:Sound barrier

Place of Origin:CHINA

...barrier, or acoustical barrier) is an Sound insulation and noise reductionexterior structure designed to protect inhabitants of sensitive land use areas from noise pollution. Material: Metal type: galvanized sheet, aluminum sheet. Appearance: shutter type,

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

Brand Name:TC

Model Number:TCNB

Place of Origin:China

... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absorption and sound ...

Brand Name:Aonike

Model Number:BT800

Place of Origin:China

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ...

Brand Name:huashida

Place of Origin:Qingdao, China

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-...

Place of Origin:China

Brand Name:AEROPAK

Model Number:APK-8620

750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam 750ml Expanding Tube Foam Multi Purpose Construction Use Noise Resistant Description: I-Like PU Foam Sealant is made of high quality one-component polyurethane material. It has a ...